NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209723_1026568

Scaffold Ga0209723_1026568


Overview

Basic Information
Taxon OID3300026311 Open in IMG/M
Scaffold IDGa0209723_1026568 Open in IMG/M
Source Dataset NameAnaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3401
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor → Anaerobic Biogas Reactor Microbial Communites From Washington, Usa

Source Dataset Sampling Location
Location NameWashington, USA
CoordinatesLat. (o)47.6525Long. (o)-122.3049Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F064748Metagenome / Metatranscriptome128Y
F092110Metagenome / Metatranscriptome107Y
F103501Metagenome / Metatranscriptome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0209723_10265682F103501AGGAMIKNIVLEGVVSYDDEYDLWCVGEDFIENIISDFDGKKVVVTITVI
Ga0209723_10265683F064748AGGMKRYRFIGNMDDVTPCKSMDAECIAAGCKGKVWGQCHFDPLLNLLSSGAEYFAEILTEYVIRDTVFRVEKDGAYSKGGLYPLFSDNGKLWMEAGHLKNHFKQRTAYNCETHTPIYLYQEYPEDAEVVEYALVEVKRTPVRKFVEGDV
Ga0209723_10265689F092110GAGMEVKLSYEPWGYKNVDAVIDSVDVEYHYDEAHNCGVFQPVVVCYVGKYRMTFNGPINWETLVIKPCRKVQVKDLRVGDVIENSVWRGFVEKVFSDKYVGVQWFDKLNNPTSYYNYSSDEMIDVEVVGHIDLWNL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.