NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209723_1074794

Scaffold Ga0209723_1074794


Overview

Basic Information
Taxon OID3300026311 Open in IMG/M
Scaffold IDGa0209723_1074794 Open in IMG/M
Source Dataset NameAnaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1515
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor → Anaerobic Biogas Reactor Microbial Communites From Washington, Usa

Source Dataset Sampling Location
Location NameWashington, USA
CoordinatesLat. (o)47.6525Long. (o)-122.3049Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029451Metagenome / Metatranscriptome188N
F054066Metagenome / Metatranscriptome140N
F062734Metagenome / Metatranscriptome130N

Sequences

Protein IDFamilyRBSSequence
Ga0209723_10747942F029451GGAGGLVVDFEDLISSTSSNAGKPSIIEALLSTVDAIFTNNRMLQRSRLSSRNIRGVVRVIGSQAFLRARLERSYKPFLDPDTGEFTYSRYDNRVLTAVCEGALSGRISLDGKSRDEIIRIFQAVGNTGQEQPVGRGGGILGRFDY
Ga0209723_10747943F054066AGGMFGMSRKPKELNRFRVGKGSPGLKAVMYRMANKSYLDIRIYRGYREVTRIVTPDTGMRRFVVDGVGAFVMPNEEQMLRQLHDRHALYIPYNINSSAPGEVTDDLEPVAFVYPPLSPAEFQTELEAQTVADLLAETEKDMSWIWLLAGGAVLIFVLILLFGGA
Ga0209723_10747945F062734N/AQIHWEITDGEPPYTVFINGIEIVSGYPGTVISTDAAPGRQYTAVVMDNQSVADATVTGEYYTYPLWVWLLFAALVVCLIVSIWLPYAAFGAAIAGGFLLLMVAPNPDYAAYLRIFAGGAFIVGLAGLAGRLQG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.