NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209761_1000470

Scaffold Ga0209761_1000470


Overview

Basic Information
Taxon OID3300026313 Open in IMG/M
Scaffold IDGa0209761_1000470 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)24554
Total Scaffold Genes26 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)21 (80.77%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameAngelo Coastal Reserve, California, USA
CoordinatesLat. (o)39.718176Long. (o)-123.652732Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001912Metagenome / Metatranscriptome618Y
F002514Metagenome / Metatranscriptome552Y
F014881Metagenome / Metatranscriptome259N

Sequences

Protein IDFamilyRBSSequence
Ga0209761_100047010F002514AGGTGGLRDRDVMNLLDQIELYVVGIGGERNAQKDYWLFIYNSMRSGLLMTKDMEKHLQYKLKGLGIENPRR
Ga0209761_100047020F014881AGCAGGLPVASFVILAFTVFVLAGGLFILVGAGTSVSLLNVQQGLGFVYPHDINNQTPAEGVFVALLYAFGVVGLYMMFMSTRNAYRPKRAYSFLGFGMLLSFVFMATAYFVLYQKLM
Ga0209761_100047021F001912AGGAGMSLSPWNDGSDPDQLTGLTWDIQLVGHCKILAWQLAKLPGYRREGAVEVRPFTAKKKLWASEAQGISGEAMKGNPTTTVIPRVDESKSSPRATEDLTERKAGLIIGDGHSPT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.