NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209155_1002395

Scaffold Ga0209155_1002395


Overview

Basic Information
Taxon OID3300026316 Open in IMG/M
Scaffold IDGa0209155_1002395 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8673
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (69.23%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009323Metagenome / Metatranscriptome319Y
F024995Metagenome / Metatranscriptome203Y

Sequences

Protein IDFamilyRBSSequence
Ga0209155_100239512F024995N/AMRVSDSSWTNPRDNFESVPKSLSPDQRFAAERAFSSVLVNTVREAVGDALGRNVLEILTSKGLLDASNNSKEFDSKLRSLFGNGAAVLERIVVKDLNRKLGIPYDSDARFDYEKSLETAREVCFVESRLK
Ga0209155_10023959F009323AGGMVDTVVISTLYFISVFQLILQAGVVFYAYRVTKLTGSFRAWTLIIAAFTLLTVRNVVSLVLSLSLPADQLGALIDSVGVVTLILSSVVNIAAGVALFLGMFGLAKRFENQSKAPP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.