NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209471_1000022

Scaffold Ga0209471_1000022


Overview

Basic Information
Taxon OID3300026318 Open in IMG/M
Scaffold IDGa0209471_1000022 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)151739
Total Scaffold Genes169 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)100 (59.17%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008224Metagenome / Metatranscriptome337Y
F012567Metagenome / Metatranscriptome279Y
F031219Metagenome / Metatranscriptome183N

Sequences

Protein IDFamilyRBSSequence
Ga0209471_1000022125F008224N/AVLGCHLAKLGKRPAGYNGRGTKRSQRLPAGLDCGGVAVDPKQPAARCDPLQDLAGMARLPEGAVDRDRPRSGLEQLYYLL
Ga0209471_1000022149F012567AGGCGGMAAVRHRKSSRGRSLLASSGMRIAESHALLFQSKLLLLNSANHSYRRTRARKDLKRVEHFRSELNRTEAALRRTGLDELALENGDFWLQVYADLIDCATASLDRMRSGMSWREADDRFETATDVQMLEELLAQWTSRMHLIRQSTADGGHRKV
Ga0209471_1000022150F031219N/AMCPGTGRPSAVSPHVGEDDGDKLLPGEASSAHSGDVNDARRWLETYDELCRLKQKILTDLESQKVHVPPEGDAEVKDDEAMLRAEYERLLGRREFWHAEFEARQDR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.