NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209131_1005249

Scaffold Ga0209131_1005249


Overview

Basic Information
Taxon OID3300026320 Open in IMG/M
Scaffold IDGa0209131_1005249 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8464
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (100.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameLaytonville, California, USA
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001114Metagenome / Metatranscriptome774Y
F018790Metagenome / Metatranscriptome233Y
F019713Metagenome / Metatranscriptome228Y
F094178Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0209131_100524913F019713AGGAGMPHAMSQTSEDIISGILNWVCPECGGRMGGRTKEFKCQGECLTDWRNVWERRVGKPGKKANSPQALGKQYEDYATTEVAREAHL
Ga0209131_100524915F018790AGGAGMAKVIEFYVPKNFRNAFVLAAQPQRGKVIEFCSQAKKSVPPRAAGEVLGWLLMETESDVAVGSQWPSRL
Ga0209131_10052494F001114GAGGMSDQHSFISPDHFHPDPYTNSRTAERTLNAAIVHAEISRSYEEYFEIFDEFYADDIEGSSETMEEPIRGKERVRSLLFSFLVPLHAMAEVGGVSISIRETAIPGDAIDETHSAWTLELVGVSGKICTVNWRILRKWNESRVVLEHHYDHQQSGESLNERDLRFDAPEAAIGLQRPS
Ga0209131_10052496F094178GGAGMEKHIEHNKAKNEQSLSDREIWWKIRYLDPDIKRSDGVLIVTVLAILSIVGVVVALLYSRGL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.