NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209472_1056356

Scaffold Ga0209472_1056356


Overview

Basic Information
Taxon OID3300026323 Open in IMG/M
Scaffold IDGa0209472_1056356 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1668
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012567Metagenome / Metatranscriptome279Y
F031219Metagenome / Metatranscriptome183N

Sequences

Protein IDFamilyRBSSequence
Ga0209472_10563562F031219N/AMADDDGDKLLPGEASSARSGDVDDARRWFETYDELCRLKHKILTDLESQKVRVPPEGDAEVKDDEAMLRTEYERLLGRREFWHSEFEARQDR
Ga0209472_10563563F012567AGGCGGMAAVRHRKSSRGRSLSASSGMRIAKSHALMFQSKLLLLNSANHSYRRTHTRKDLKRVEHFRSELNRTEGALRRTRLDELALENGDFWLQIYADLIDCATASLDRMRSGMSSREAADRFETATDVQMLEELIAQWTSRMQLIRQSTADGGHHKV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.