NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209801_1000012

Scaffold Ga0209801_1000012


Overview

Basic Information
Taxon OID3300026326 Open in IMG/M
Scaffold IDGa0209801_1000012 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)142335
Total Scaffold Genes139 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)88 (63.31%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000436Metagenome / Metatranscriptome1146Y
F008567Metagenome / Metatranscriptome331Y
F088619Metagenome109N

Sequences

Protein IDFamilyRBSSequence
Ga0209801_1000012101F000436GAGGMTTLPLVLDDHEPIGIILRAGRTMLRPARIWAYCWFTDEAESGDGDHTHRHLPEHID
Ga0209801_1000012123F008567AGGVRPAAAAVLFVLGQAAPAQEITIGPQAVLASYREVVSGLRYAGFGFGGAMSVRFHKLSVDGVVTRVKLDTADGSAATQSFTATQFDVWVGYDVAPYASLEVGIIRRTADPELDAQSVGAVRLGARSFYEIGPGATILFRANYLAAPKFSGGGRAPFSLDLGLGLDVRLAGRLRGTAAYAFQRINRKTSPGSTGEIDAPIQETVGRVGLALAF
Ga0209801_10000123F088619AGGAGMKRIAMVLALVAMGACQKQEQKPAAQSQMADTSHMMMADTSKMMMADTSKHMMMADTSKKMMAPAAKPAAKPAPKKKP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.