Scaffold Ga0232081_102356

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0232081_102356

Scaffold Ga0232081_102356

Overview

Basic Information
Taxon OID	3300026385 Open in IMG/M
Scaffold ID	Ga0232081_102356 Open in IMG/M
Source Dataset Name	Metatranscriptome of enriched culture of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1.36 (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3182
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Cloacimonetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium → Enriched Cultures Of Pce-Dechlorinating Microbial Communities From Ithaca, New York, Usa

Source Dataset Sampling Location
Location Name	USA: New York
Coordinates	Lat. (^o)	42.4447	Long. (^o)	-76.485	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031111	Metagenome / Metatranscriptome	183	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0232081_1023562	F031111	N/A	EKSRFLIGKKRCISNIPQNSYYQTIVNIPAAYNFCCYYPQNLPSSQIGKQVKKILKPLNLALIKLSKPKLTFP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.