NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256815_1018942

Scaffold Ga0256815_1018942


Overview

Basic Information
Taxon OID3300026463 Open in IMG/M
Scaffold IDGa0256815_1018942 Open in IMG/M
Source Dataset NameSediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 CS6
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)748
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment → Sediment Microbial Communities From Tidal Freshwater Marsh On Altamaha River, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.3377Long. (o)-81.4644Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013930Metagenome / Metatranscriptome267Y
F056119Metagenome / Metatranscriptome138Y

Sequences

Protein IDFamilyRBSSequence
Ga0256815_10189421F056119N/AMHLRSVVGVIELEVWQGQDPHDGHWGSPVRELWGLKAHQQMSPALAEKLAFTATLAGSYAAAGQLAAKWGSAVDDSVVHALVQRVGSQAEAQMQARLEQVPQEREPQRGDSALGVIMMDGWQARFRGPGWGKKNTQKERVAWHEMKTGIFYLHEQAGVTQGGRG
Ga0256815_10189422F013930GGAMNSDHQPVRSLREIEMEVLEEGREWTRRRLEERLQEEANRHGGVFPPQRPKGAPPQAPDDASTQRRRGH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.