NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255166_1036717

Scaffold Ga0255166_1036717


Overview

Basic Information
Taxon OID3300026473 Open in IMG/M
Scaffold IDGa0255166_1036717 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1001
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.4271Long. (o)-81.6053Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006266Metagenome / Metatranscriptome377Y
F009598Metagenome / Metatranscriptome315Y

Sequences

Protein IDFamilyRBSSequence
Ga0255166_10367171F009598AGGAMLDKQNIVVESLESPPGNKGIEYQIAHEVYLKMVDYLRLTQAKNTLNRMSDYHYLNIPVSNSTEPIRGIDYIYPVVSPGVDYATAVITKCLMPQGKINFEFERFTEHDKGAVQATEMVKYMLNSKNDSYQIIRDWAQDSLLHKNGIVMVSPIRNPIVQYKE
Ga0255166_10367172F006266N/ATIYLHRQITVPNGETPDEYVHYLLDRESKGVPIALPHDAATAGRYTLTEQSVREVFEDTYGLNCIPGAILNPPNDQGKVTNHKAYGINIMRLGMERGTFMINESCKAFLDEARNYAIDDAGRFTERDDHIDSARIGVLALIQGHGESVVSRANSFEFRRFKPVEGKVQRI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.