NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0228604_1041971

Scaffold Ga0228604_1041971


Overview

Basic Information
Taxon OID3300026506 Open in IMG/M
Scaffold IDGa0228604_1041971 Open in IMG/M
Source Dataset NameSeawater microbial communities from Monterey Bay, California, United States - 4D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)716
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.8313Long. (o)-121.9047Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F060814Metagenome / Metatranscriptome132N

Sequences

Protein IDFamilyRBSSequence
Ga0228604_10419711F060814N/APGCFVHRRGNASDKSQVYMAKEFIRDITDQGILVDEILIGPTDFLASENFYEVMPELVDIINENSPILAFVSTLIDGDIKKFCNFLMDNINLDTEIEIGIATNPHKFFTDEYTKHISDMLAYIDKHIMHEVTYTFVVNIKDYGLDYEALHDQAVKRFDTILDFIPSVSRSHKANIILKTLDEFNEYFSTWHQESKLNNIMVDHSHAGINYTVLNYKRGEWYLSPFMYENMAIYDDMFK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.