NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209809_1015897

Scaffold Ga0209809_1015897


Overview

Basic Information
Taxon OID3300026509 Open in IMG/M
Scaffold IDGa0209809_1015897 Open in IMG/M
Source Dataset NameAnoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3174
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location NameUSA: Wyoming: Yellowstone National Park
CoordinatesLat. (o)44.963Long. (o)-110.715Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037517Metagenome / Metatranscriptome167Y
F039435Metagenome / Metatranscriptome163N

Sequences

Protein IDFamilyRBSSequence
Ga0209809_10158972F037517GGAGGMRVRQIGTLVFDANTNIVVDASNQDAPGIGFRVNGLFDPQPFSVEIAFRRATRQQALDAVNTLARELHSYAQRRQDGRLAVAGGVLVVAEDATGGASLRSYLRDGSVTLLGVEATANGVLARVRVTGTLINPFLNYTLTQNTLSSLLPYERRVATLSGLSDAYLYKHDLQYFASNVAGLYNALIAVEELESATGTSRIVAINPATASSGIILQNWNAGWQTLTRANFSTATSGTITYTVGTAFPHDVYRLFIEIFCPTTPSSNARYIVSWNGQPQIAETIVGDRSWYTPALFVRDDASITLTLEIQNVPTGTLVMPVVLIPVDGVSVWSALTAPPLFAVLIRSTQNATSRLLSTFPSGTVYGAPGAVTSRYIAVFNGMMVPTITGAFADLVIFSHRIEPASFA
Ga0209809_10158973F039435AGGAGMLVAITRPHQQFPVPLTVADYEFSTSDDGDERGRVTLPPGYARSGVMTQIGDELIVYCTQLSRTVWRGQIERIEEARDGSITWHA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.