Basic Information | |
---|---|
Taxon OID | 3300026514 Open in IMG/M |
Scaffold ID | Ga0257168_1155251 Open in IMG/M |
Source Dataset Name | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 510 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Vulcanisaeta → Vulcanisaeta distributa | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From H.J. Andrews Experimental Forest, Oregon, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Oregon | |||||||
Coordinates | Lat. (o) | 44.23 | Long. (o) | -122.22 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003391 | Metagenome / Metatranscriptome | 489 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0257168_11552511 | F003391 | N/A | MRKIRKITRDKKGIDTILAALLMVVIVVVAAVMVYAWATGLLSALLVQNPVPKESMNFESFAFNVNNQNLTLSVRNTGSVAIAFASYYVKDSNGNQYARLNWPGDNAGQYPASVNPNNLVSVNIAISTKCGSSCTGATYQFSSGLSYTVTVVTTRNNQFVWQGTR |
⦗Top⦘ |