Scaffold Ga0209806_1211020

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209806_1211020

Scaffold Ga0209806_1211020

Overview

Basic Information
Taxon OID	3300026529 Open in IMG/M
Scaffold ID	Ga0209806_1211020 Open in IMG/M
Source Dataset Name	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	668
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Halobacteriales → Halococcaceae → Halococcus → Halococcus agarilyticus	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location Name	USA: California: Angelo Coastal Reserve
Coordinates	Lat. (^o)	39.7392	Long. (^o)	-123.6308	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016790	Metagenome	244	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209806_12110201	F016790	AGGA	MNEKSTSAATNRPTTYSKRLLETALVLAAVTAVLHLYIGILVYGIPLGVPLILIALVYLGGIGLIAVNNRRERWLKIGIYWVIIVIVLWAASAAVNAPNTNIPLAYVDKAVEFILLGILL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.