NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209648_10000005

Scaffold Ga0209648_10000005


Overview

Basic Information
Taxon OID3300026551 Open in IMG/M
Scaffold IDGa0209648_10000005 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)111629
Total Scaffold Genes91 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)69 (75.82%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameLaytonville, California, USA
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002583Metagenome / Metatranscriptome546Y
F006482Metagenome / Metatranscriptome372Y
F090732Metagenome108Y

Sequences

Protein IDFamilyRBSSequence
Ga0209648_1000000531F090732AGGALSLLLYSFFALIGLLLLLFAWSVRSPKRPARRSSSVGAVGECEHKHVTYLPQIRQTFSKADYEFLSKNAPPGVLRRVHRERRRVALAYLEALRDDFQSLLQMARVIAVLSPELEAVHEFERLRLTAKFTCQYQMIRWKLLGGAAPVPQLSGLSDFVSGLSVRMEAAMKELGERAAVAAALASSMNRRGLDAG
Ga0209648_1000000542F006482N/AMEAARQNRRRSISASICLLMVVLLYAPFAGAAWASYQMACCTSGQCPIAAHHHHKAPAAPANPMDCGHDMSGMMACAMSCCHDSDRSQFTSIAFVLPPPVASAAVAAIELPIEFAKPLDFPRSIEPLFPPPRFVSAAA
Ga0209648_1000000548F002583GGAGGMKRLVPIPCGCAEHLKGAEETGFGYQVVSVQLKDGRVFEQVVISEGCIIEVRGYREIPFACEDVASVSVNHKHWNFRDQSDTRAKSRAATA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.