NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209648_10003194

Scaffold Ga0209648_10003194


Overview

Basic Information
Taxon OID3300026551 Open in IMG/M
Scaffold IDGa0209648_10003194 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13739
Total Scaffold Genes21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (71.43%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameLaytonville, California, USA
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000092Metagenome / Metatranscriptome2385Y
F004291Metagenome / Metatranscriptome445Y
F009088Metagenome / Metatranscriptome323Y

Sequences

Protein IDFamilyRBSSequence
Ga0209648_1000319410F000092GAGVKQHLGRQAGVQTVEVSLLDGKVDVIPKEDGQIDPAQLLKATHDSGVTAAEMDITARGKIVKDSSGSLALQVEPNRSFAFAPNELSKGLESLAGTQTVVTVRGQLYKKPAGKKKADLSAPLKLLILEVQKKE
Ga0209648_1000319415F009088AGGAMENCRIDELRAELDHLFKQQTEVLESRSFGAATDTEIFEYEIRQEIIHDICNELANSVAV
Ga0209648_100031949F004291AGGAGMNTGRRVALLVLLGSIVVVPVARAQVKHIEMRVEGMT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.