NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209648_10012890

Scaffold Ga0209648_10012890


Overview

Basic Information
Taxon OID3300026551 Open in IMG/M
Scaffold IDGa0209648_10012890 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7286
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameLaytonville, California, USA
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F042798Metagenome / Metatranscriptome157Y
F104534Metagenome / Metatranscriptome100Y

Sequences

Protein IDFamilyRBSSequence
Ga0209648_100128901F104534N/AAVDALESCTCLPQFCQILRQCLEPIGFDGFGLYISSGLPAEVELFPLIRVNGSKLQFFWDQLPASSDTNWSLAFSLMKRNGKRLGVFTLYRKNTASPLWMDLEVFTTTGFSSAVAAFMEKVQDSWPVKAQKERSPIPAFEKAGAVIASRSRQSVAVPSSG
Ga0209648_100128905F042798N/AMPSSTSDSKSTAISCAKTLVGITALLIIALEISSAYLLKHKSVTYARISRQYEGALEMRPAQPGAPPSVLMVGNSLLLHGVQLDRLRTLTSSSMRIYPIFLEATGYYDWLYGLQRLFRQGAKPQIVVVGVGVNYFLEDGVRHDYVPMLFFDTRDTLEAASDLHLDRTATSNLLLEHTSTFWDTRSVVRTQILSRVVPHLEDLFLLVNPRPAIPESREFEAITIPRLQRLRELCEAHGAKLVLLVPPTLSSETAVSQMAYAAHAAGVEISVPIDPAALSARFYQRDGMHLNSDGAGLFTSALAKDLPERIVSRDTLAARH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.