Basic Information | |
---|---|
Taxon OID | 3300026623 Open in IMG/M |
Scaffold ID | Ga0208661_101750 Open in IMG/M |
Source Dataset Name | Hot spring microbial mat communities from Yellowstone National Park, Wyoming, USA - ECH_C virus_MetaG (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3149 |
Total Scaffold Genes | 8 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (37.50%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Extremophilic Microbial Mat Communities From Usa And Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Yellowstone National Park | |||||||
Coordinates | Lat. (o) | 44.7219 | Long. (o) | -110.7021 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F066922 | Metagenome / Metatranscriptome | 126 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0208661_1017507 | F066922 | N/A | MCLDMSENVRVEDELERLKSVMTQKVQQFASDRTIRRYISRLEKLELGKVSAEQALRLIAVFLSTPLGQWLAVIIALELLAKAKFFSQISVDVLIGVVTSAELLQALANSGIVPEIAGLAGLFG |
⦗Top⦘ |