NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208548_120111

Scaffold Ga0208548_120111


Overview

Basic Information
Taxon OID3300026627 Open in IMG/M
Scaffold IDGa0208548_120111 Open in IMG/M
Source Dataset NameHot spring microbial mat communities from Yellowstone National Park, Wyoming, USA - ECH_C host_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)566
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameUSA: Yellowstone National Park
CoordinatesLat. (o)44.7219Long. (o)-110.7021Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F042977Metagenome157Y

Sequences

Protein IDFamilyRBSSequence
Ga0208548_1201111F042977N/ANPISGNPPLYYLATKYGGITVITRIYVPNPPSQTGILLSLEHIYVGYTPSIYVGSNNHLYLGDFAAGFIQVSGAISPGWNTIVFEEYTSNGEYYMTGWLNGASLGTASTTATPQLFMTGFQDWLLIGDWGGGWPNNFNFYYVGFSGGVQYFAVYGGALPSSEVNAFFATGILPPTPYLLYTAASLRGG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.