Basic Information | |
---|---|
Taxon OID | 3300026652 Open in IMG/M |
Scaffold ID | Ga0208713_101113 Open in IMG/M |
Source Dataset Name | Grasslands soil microbial communities from Nunn, Colorado, USA, that are Nitrogen fertilized - NN1117 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 680 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Nunn, Colorado, USA | |||||||
Coordinates | Lat. (o) | 40.81667 | Long. (o) | -104.76667 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013942 | Metagenome / Metatranscriptome | 267 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0208713_1011132 | F013942 | AGGAG | MPDTLEFILYLGAFLCFLLAAFSVRAAWASRVNLIGLGLAFWVFIPLVNALRRIT |
⦗Top⦘ |