Basic Information | |
---|---|
Taxon OID | 3300026698 Open in IMG/M |
Scaffold ID | Ga0208843_100906 Open in IMG/M |
Source Dataset Name | Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN411 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 564 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Willamette National Forest, Oregon, USA | |||||||
Coordinates | Lat. (o) | 44.20517707 | Long. (o) | -122.1284473 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003395 | Metagenome / Metatranscriptome | 489 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0208843_1009061 | F003395 | N/A | CSLKAIPTSGGVTASTEMLAAKRHARVLAPVIVGKMIIANQQMAYAA |
⦗Top⦘ |