NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208448_100003

Scaffold Ga0208448_100003


Overview

Basic Information
Taxon OID3300026813 Open in IMG/M
Scaffold IDGa0208448_100003 Open in IMG/M
Source Dataset NameExtremophilic microbial mat communities from Yellowstone National Park, USA - OSPB_Mat_virus_9_15 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)23501
Total Scaffold Genes30 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (10.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → unclassified archaeal viruses → Nanoarchaeotal virus 1(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameYellowstone National Park, USA
CoordinatesLat. (o)44.733Long. (o)-110.709Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021808Metagenome / Metatranscriptome217Y
F048413Metagenome / Metatranscriptome148N
F090626Metagenome / Metatranscriptome108Y
F097670Metagenome / Metatranscriptome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0208448_10000312F021808N/AMMIEEPPYGTIAWFFYEIDERQRQIYELVFDIEQKLAKVKDLLNEIDLLKAQLETNVNVGKI
Ga0208448_10000315F048413N/AMMNQEMNKVTIVIKYEKDYAEYRYILTKIDEMAEKLNIDKYLLRYLILKEFANNEKWQNELIEKLKKNG
Ga0208448_10000325F090626N/AMFRIVKFENIYFGKNSLVKLFANKTHIENSTDYDSTALAFLLDVSDFTNTDALLSHFAIVNDNEIRPILVKWNLRIIHGRLLILVNQLSGPQDTKMLLKEFESTIENQKPETIKYIAGQYAKALADAKGLQQVYNFLVQRIYQLKSIGIKKNEEEVRRLAEIYR
Ga0208448_10000330F097670N/AMMNYKIFDKDIYTETNEIITINLKTSETNLEIKRYFYDGKELKEIKDLQEYNLKIYEIVQKVQEEFTKFSTKHAKPPIGYIPISAIIFEYMLNRNNVILIAYANISKVENEISKEITNDTIKIIIKSKTIFNKEWNFESTQNLSPEVKDNVT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.