NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208662_106175

Scaffold Ga0208662_106175


Overview

Basic Information
Taxon OID3300026885 Open in IMG/M
Scaffold IDGa0208662_106175 Open in IMG/M
Source Dataset NameHot spring microbial mat communities from Yellowstone National Park, Wyoming, USA - OSPB_host_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2058
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (42.86%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameUSA: Yellowstone National Park
CoordinatesLat. (o)44.733Long. (o)-110.709Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F080247Metagenome / Metatranscriptome115Y
F081547Metagenome / Metatranscriptome114Y
F087442Metagenome / Metatranscriptome110N

Sequences

Protein IDFamilyRBSSequence
Ga0208662_1061753F080247N/ALIDCLIDADVNYLNGELFNSQFRVKGKFLAFGNLYTLEKTTPGGEAIQVCVPIDATFMAYYQGMVAIMSFYFRDRDLYANVSLTDPDTIKDFITMSTYYRKYGVSIPNVLDKIMYRKVPT
Ga0208662_1061755F081547GGTGGMPYLRGVFVNFGEETYYLSCGIVNGGSLDTETYTISNPELMMVRLGRDLYVVTSELKLLIPVEPVRVLLNSETSKVYNEVLSQGNEVRPS
Ga0208662_1061756F087442GAGGVMREGLVKAGDLVIDCKPCYVAGTGFTKDNIYVVSEGTVVFKWYDKIAVVTVGEEGTKVNLLDIIDVRFLVERNENCVAIRL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.