NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207822_1009822

Scaffold Ga0207822_1009822


Overview

Basic Information
Taxon OID3300026981 Open in IMG/M
Scaffold IDGa0207822_1009822 Open in IMG/M
Source Dataset NameTropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 67 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1086
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NameLuquillo Experimental Forest Soil, Puerto Rico
CoordinatesLat. (o)18.0Long. (o)-65.0Alt. (m)Depth (m).1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F096165Metagenome105N

Sequences

Protein IDFamilyRBSSequence
Ga0207822_10098221F096165GAGGMEEKAKEIDAFWKRVQADGSAGTACVRTMLEQEKTDHNFQFDAAAVLYQADHSPATLTLVRDSIAQADFQDSDPASYLSLALELGQSGVDIQVLAAKFLRYPDAVIHVPEHALDLDSDTAALFLYGSMEPVLASKALIEQLKAPELNVRSAAAHLLAEQMTEESFRALSQWDGFSKIGEEFRRNDIQAIMKYKAPNPDDFAHPKWTREQVLRVIAGLPHTRKEFDDAMASKGAAFDQQVREKKPSQEELSKIVAESEPIYGIADRTSFIASAIATLKPEDFVTIREARCKSLFNVSDESLSEYLAFTQVMIGLLNRL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.