NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207824_1007742

Scaffold Ga0207824_1007742


Overview

Basic Information
Taxon OID3300026990 Open in IMG/M
Scaffold IDGa0207824_1007742 Open in IMG/M
Source Dataset NameTropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 73 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1213
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NameLuquillo Experimental Forest Soil, Puerto Rico
CoordinatesLat. (o)18.0Long. (o)-65.0Alt. (m)Depth (m).1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002450Metagenome / Metatranscriptome558Y
F060221Metagenome / Metatranscriptome133N

Sequences

Protein IDFamilyRBSSequence
Ga0207824_10077421F002450AGGAMTETSTAEHTDRRATSRIDAHLPLFIYGSLLGGDPFYEETFTISINGTGGLILMASTVQPGQRIMVTNQGNDQTQECVVVSVTAQPAGSYVAFKFPTPMPQFWHGLEIGKGTLRSWLEYFIEALILQIRGDHTPETPVPDKFYKRGSQESFVLPSPRE
Ga0207824_10077422F060221AGGAGGVSSNQVANAPKRRSSRIPKAIMLAVQSVDPSRAPYREEVTTGSISCHGCTYKMRHEPRPGDIVVLDTGSGSTSHS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.