NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207722_1007644

Scaffold Ga0207722_1007644


Overview

Basic Information
Taxon OID3300027003 Open in IMG/M
Scaffold IDGa0207722_1007644 Open in IMG/M
Source Dataset NameTropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 26 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1301
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NameLuquillo Experimental Forest Soil, Puerto Rico
CoordinatesLat. (o)18.0Long. (o)-65.0Alt. (m)Depth (m).1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003485Metagenome / Metatranscriptome484Y
F005680Metagenome / Metatranscriptome393Y
F010361Metagenome / Metatranscriptome305Y

Sequences

Protein IDFamilyRBSSequence
Ga0207722_10076441F003485N/AHSRARVDGRSRQSAMTAEADLHVEVQGVEIVVTLPGTNYAVTYFRASAFPQQLLTKSHSGREDHGAPMTQAEFHGRAWKLANDKARELGWIV
Ga0207722_10076442F010361GGAGGMGTLIFVCSTTGHEVSTGVEVDRSSFKKVSRSKTAIFCPRCRKNHTLAALWAWLVDEVPQAPDESRSTKSAA
Ga0207722_10076443F005680AGAAGGMRGLADIHLDVRGGDIVVDLPGTSYTATYHKPAVSPQLLATDLPVKDDPRAKLTLAEFLSRAWRLANDKARELGWLA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.