NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209295_1078792

Scaffold Ga0209295_1078792


Overview

Basic Information
Taxon OID3300027028 Open in IMG/M
Scaffold IDGa0209295_1078792 Open in IMG/M
Source Dataset NameMarine algal microbial communities from Porto, Portugal - Porto_5 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)522
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium → Undibacterium baiyunense(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Marine → Genome And Metagenome Analysis Of Marine Red Algae Porphyra

Source Dataset Sampling Location
Location NamePortugal: Porto
CoordinatesLat. (o)41.162Long. (o)-8.622Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F086530Metagenome110N

Sequences

Protein IDFamilyRBSSequence
Ga0209295_10787921F086530N/ALANTDVRYDRTMAHGLGRLRKDVSATFGRDAEWERTPALRVFELLNRFVKAGNDNDVSEGIALYLLPEFTKGDLKRAFYTIMPSLQGGRSGEVCSYMELVNWLLRKYADEQSLSDQDALFHGASQENGETENDFYVRLRGLRRLCGYIHTEGQMKSRYMQGLGWEIRADVREHN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.