NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207766_1007640

Scaffold Ga0207766_1007640


Overview

Basic Information
Taxon OID3300027042 Open in IMG/M
Scaffold IDGa0207766_1007640 Open in IMG/M
Source Dataset NameTropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 68 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1305
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NameLuquillo Experimental Forest Soil, Puerto Rico
CoordinatesLat. (o)18.0Long. (o)-65.0Alt. (m)Depth (m).1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000859Metagenome / Metatranscriptome858Y
F005032Metagenome / Metatranscriptome414Y
F005719Metagenome / Metatranscriptome392Y

Sequences

Protein IDFamilyRBSSequence
Ga0207766_10076401F000859GGAGMPREESRSARSTGPTGSEFFNALQEMSRDWMGRATAEVELGLKLSKNLTAAHSVPDAITAYQEWLSEEMNARAEDARLLMSNGQKVMDASSRLLSSSWTSGRMST
Ga0207766_10076402F005719N/AMTIDLTRDEIWFLKALRAAGERGRIVSAVASNAGLARLVEMQYVTKQPQSEQKTLYVITDRGRQAVASAPQ
Ga0207766_10076403F005032N/AEVSRQSTNLFSAMEVAETIGADLETINAWLQVGAIDRAVFGGGRFSKYELQRAALTFELVKFGLSPSSARDVVWEMEYDLQRIWAGTISNQYKAYAVVIPNKQKKWLVIWCWKASTEEIDPSPQSHIILPISDILARVTNDAEQARQH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.