NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255074_1000832

Scaffold Ga0255074_1000832


Overview

Basic Information
Taxon OID3300027121 Open in IMG/M
Scaffold IDGa0255074_1000832 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4635
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (76.92%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)46.1812Long. (o)-123.1834Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000473Metagenome / Metatranscriptome1097Y
F000671Metagenome / Metatranscriptome945Y
F010248Metagenome / Metatranscriptome306Y
F011938Metagenome / Metatranscriptome285Y

Sequences

Protein IDFamilyRBSSequence
Ga0255074_10008323F000473AGAAGMFIDKSSDKQREHFKYGINHWTGEPAKPVFYTEEMKKKVHQIKKPSMLLMDIVMYPDFLALRLYEDNFLQFEGTKKEMVIDYVGKVKKLIESYGVRCELEGKPSERVL
Ga0255074_10008324F011938N/AMESDASWRASPVKEYYDTTHIVFIHAEQCHGTVEKLGAWASIVRYNKDGIEHNELMENEDFTIIDEIVFKHIEESE
Ga0255074_10008325F000671GAGGMEKILCYSCNKSKNKLDVRKSSLLPINLLICEACYSAKLEPRWVIILAGRQSGSDSVKEFIIKRRYIGNEISASELLV
Ga0255074_10008329F010248GAGMRKSDRIRLLEMEMLRMQFQIEYLSTAVTLLLEENKVKGPDMDAGKWYTAKLNKDK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.