NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255074_1002804

Scaffold Ga0255074_1002804


Overview

Basic Information
Taxon OID3300027121 Open in IMG/M
Scaffold IDGa0255074_1002804 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2523
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (55.56%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)46.1812Long. (o)-123.1834Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000671Metagenome / Metatranscriptome945Y
F012975Metagenome / Metatranscriptome275Y
F073544Metagenome / Metatranscriptome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0255074_10028043F012975GGAGVLNLTLKGVEVFMERSKHNKQESYWDNYDLLIWKKDPGGFTNVKGMFRKDSWGIAERVPVNENGIWKLPKHYVKYFK
Ga0255074_10028046F073544AGGVREYYEVINIVFIHELRLWGTCDLLGLYASKIKYQKDGIEYEDMFDNEEFTVMEEIVLEHAEEDN
Ga0255074_10028047F000671GAGGMEKILCYCCNKTKNKLNLKKSVLIPINLFMCETCISSKFEPRWVIILAGRQLGSESVKEFIVKKKYIGSEITASELLV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.