NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255090_1004032

Scaffold Ga0255090_1004032


Overview

Basic Information
Taxon OID3300027123 Open in IMG/M
Scaffold IDGa0255090_1004032 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3339
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)46.1812Long. (o)-123.1834Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001872Metagenome / Metatranscriptome623Y
F002421Metagenome / Metatranscriptome560N
F002794Metagenome / Metatranscriptome529Y
F010535Metagenome / Metatranscriptome302Y

Sequences

Protein IDFamilyRBSSequence
Ga0255090_10040321F001872N/AHLDVATAKTNSDARPYTGNSDGPSAGPRAGMNEWIKQAIAASNNAVWNNGSWGIRDMRGKTGSLSVHATGRAVDLSYRKSERHPKAGRLNACSFIDVVVANANTLGVECILDYFPAPYGRAWRCDRQAWKKYSKPTIHGAPGGDWFHIEITPQAADSVIFVKAAFLKVFGEIPPKA
Ga0255090_10040322F010535AGGAMTDPQIVDYSVYTGVMDNGQEILVQIFTSPESGKFLMGQIAFRSHASSWGVPIPLEKR
Ga0255090_10040324F002794GGAGVSEGVSYNQGELTEETRKMVLESSAMANHTMTMFGLIEDIMAVSKNPHASIIQRLKTMKNQLSLEDPMPLYDVTTLDLAIKALQAHS
Ga0255090_10040325F002421AGGAGMKTCTICKGSIAYPEITGKTHFVCDGRVPAKKLAPFIQGMLASQSSADARWTRDEQNKVDAAILHVARTKGFFTSDDIWQHLGDQFPVTKGIAGRLNAAARRGIIRNTGELAYAQRGGAHDHAQRLSVWAGI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.