NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255064_1001918

Scaffold Ga0255064_1001918


Overview

Basic Information
Taxon OID3300027138 Open in IMG/M
Scaffold IDGa0255064_1001918 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4180
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)46.1812Long. (o)-123.1834Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003422Metagenome / Metatranscriptome487Y
F099312Metagenome103Y

Sequences

Protein IDFamilyRBSSequence
Ga0255064_10019181F099312GGAGGMSFLENENQMVIDATYSEIGEMLVEDWVNSNLDEGQLYADYR
Ga0255064_10019188F003422GGALSVGPGTILSMTNELISSKYTFVCDPNECDCLIELTSSDGFGFPSGVTELTCPCGRKTTLVSVEHATIAPSNQTKEEKMEESTIGSDATHSPAVEYNPNQLVTYKIIHGYSDPEYATAKVASLEWDLHNARQAQKTNGVLTNKISLVKDIITEAYANSDDQDTLRDIAEALSIELTRTIEWSATIEVSGTIELDLLADADTDVEAEIYDNLYVESQNGNIEVSDTEVTNVREN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.