Scaffold Ga0208952_1006708

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0208952_1006708

Scaffold Ga0208952_1006708

Overview

Basic Information
Taxon OID	3300027182 Open in IMG/M
Scaffold ID	Ga0208952_1006708 Open in IMG/M
Source Dataset Name	Bulk soil microbial communities from Harvard Forest, USA - 3Bulk_unsorted metaG (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	576
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Bulk Soil → Rhizosphere And Bulk Soil Microbial Communities From Harvard Forest, Usa

Source Dataset Sampling Location
Location Name	Harvard Forest, Massachusetts, USA
Coordinates	Lat. (^o)	42.5502	Long. (^o)	-72.1737	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045267	Metagenome / Metatranscriptome	153	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0208952_10067081	F045267	N/A	VGGMPMDCKQANATAFRQWRSWLPGGGFEPPTFGLCDLTHLSVRVGLYLHPRGMLAIQSPRLPPPFRGLGSVLPYRSRDVGSTDFDE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.