NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208673_1000276

Scaffold Ga0208673_1000276


Overview

Basic Information
Taxon OID3300027192 Open in IMG/M
Scaffold IDGa0208673_1000276 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15858
Total Scaffold Genes44 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)34 (77.27%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameColumbia River Estuary, USA
CoordinatesLat. (o)46.2Long. (o)-123.94Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001562Metagenome / Metatranscriptome670Y
F003965Metagenome / Metatranscriptome459Y
F047059Metagenome / Metatranscriptome150Y

Sequences

Protein IDFamilyRBSSequence
Ga0208673_100027632F001562N/ALFQILIVLNGKRLQMKSQFEIDLEIKESFIDLLNDVYPTVKIGYSTFTPAEILECCDPIAFSIGLIEHEDYLAEMENE
Ga0208673_100027639F003965GAGVINKKGSQMITLNTMCREHNPMKSAISEVLDTQYTFCQDCEQNIERWYDDTDPERLPMWTNWRVR
Ga0208673_10002767F047059GGAMKIHLISLNQDLEDARNNEPLNEDEYWESDSFYMGAIDATEHLLSVATDIMNSTSERYE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.