NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208800_1000767

Scaffold Ga0208800_1000767


Overview

Basic Information
Taxon OID3300027193 Open in IMG/M
Scaffold IDGa0208800_1000767 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4078
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameColumbia River Estuary, USA
CoordinatesLat. (o)46.2Long. (o)-123.94Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001733Metagenome / Metatranscriptome644Y
F039641Metagenome / Metatranscriptome163N
F050378Metagenome / Metatranscriptome145N

Sequences

Protein IDFamilyRBSSequence
Ga0208800_10007675F039641N/AMIPAAYSTALKNAIQAYSYADRVAIWRTVNQADGIGGVSQHWIQVAEIRGTISNTGDTEGIVGGMIEQSGTWTLTCSPDIEVRADDRIYTSGNPQNLAPYYECIGSDYGHTNAVSQTIGLRARTNG
Ga0208800_10007676F050378GAGMSPEMWVQIGIQAFITTMSIGAAWVALQVRLTRLETQVAHIINTLDGQQQEVRRIEQRLGKLENKVSALEAIIQR
Ga0208800_10007677F001733GGAGGMNSISIKRLVVVVIVAFVAAFTSVFGDGVRTSEAHDLSELGAVLALYGSKAVAAGVSAAVSSVLAFLTMPFT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.