NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208677_1008830

Scaffold Ga0208677_1008830


Overview

Basic Information
Taxon OID3300027216 Open in IMG/M
Scaffold IDGa0208677_1008830 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Columbia River estuary - metaG 1546A-3 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1406
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameColumbia River Estuary, USA
CoordinatesLat. (o)46.2311Long. (o)-123.8825Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000311Metagenome / Metatranscriptome1326Y
F000714Metagenome / Metatranscriptome924Y
F001125Metagenome / Metatranscriptome769Y

Sequences

Protein IDFamilyRBSSequence
Ga0208677_10088301F001125GGCGGMGDRANFGFKQSDGNTIFLYGHWAGHEMLANLASAVSAAEPRWQDESYATRIAISNLIGEDWKSETGWGLSVDRILDNEHKIPVINWTAKTFTLFEEDLTTEVFSLSLVDFVQKYSRLVM
Ga0208677_10088304F000311N/AMYFELTAPNQVAFARATWDAELLGLDPMTIAPLTFNIGTGSIEKVSRIRDKYNLTESYVSDYEPTGYTGR
Ga0208677_10088305F000714N/APDTYNPNLLVTYKVIRGYSDAEYATDKVASLEWDLHNGRQSQKNVTTLQSKINTVKDIITEAYADSDDQDTLRAIAEALGIELVREVLFTATLEVSGTYTYNILDSDYELDLDSEVTDALYADSNNGNITIDDTEVCHVREA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.