NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209691_1003456

Scaffold Ga0209691_1003456


Overview

Basic Information
Taxon OID3300027279 Open in IMG/M
Scaffold IDGa0209691_1003456 Open in IMG/M
Source Dataset NameAnoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7359
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (88.89%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location NameUSA: Wyoming: Yellowstone National Park
CoordinatesLat. (o)44.963Long. (o)-110.715Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033339Metagenome / Metatranscriptome177N
F036130Metagenome / Metatranscriptome170Y

Sequences

Protein IDFamilyRBSSequence
Ga0209691_10034565F036130AGGAGGMSEFPVFGSGDDFLRFMEQLVEDIREGRVEDPPYHAVFLANRVEAQESLSYHRDAAVRLGFDPDRVVMLRDPISDAWVVLIPREQDDAAFEELWGHGRSR
Ga0209691_10034567F033339AGGAGMFRATLTKLDVGVVVATPSPRVRVLFDNRNHASQKVILYVGFPDKESAERVYSWLITHGYRHYDRATDTGILKPRKAERVDGMAWEIKIHRPTVELVKRFVAKDLAR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.