NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209691_1003540

Scaffold Ga0209691_1003540


Overview

Basic Information
Taxon OID3300027279 Open in IMG/M
Scaffold IDGa0209691_1003540 Open in IMG/M
Source Dataset NameAnoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7208
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (86.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location NameUSA: Wyoming: Yellowstone National Park
CoordinatesLat. (o)44.963Long. (o)-110.715Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020180Metagenome / Metatranscriptome225Y
F036248Metagenome / Metatranscriptome170Y
F069555Metagenome / Metatranscriptome123Y

Sequences

Protein IDFamilyRBSSequence
Ga0209691_100354011F069555AGGAGGMRKTIKDQAVKLAAAIREAANPEIEYRIGVFGLELADGSRPPADMLQRIQQLSIRSETVCQWAETNGARRDCKLVRSPHDGAYYFGEYRWLDNNGLRCDVVYYQVPKQLETRIRSLQAIKET
Ga0209691_10035403F036248AGGAGGMLKLFGLEEIRNMMGATEPIEGCLVVEVNLQLMQVAFTTERPSDDEWKWFEYEGEYDPRACIPLFTQTQRPVYGVFLGPVRGGNPLALLSPARGASFGVASFRGGEHRFNLFIHVAAHAAFRDRCVRLGDRLVVNFPYDPNRVARAKSLGGRFFSELKAWVFPAEREEEVKEALLG
Ga0209691_10035406F020180GGAGGMSYDAKRWYVARCSCAKPILYQDLDRYPLRCAKCGGHVYTEPRPPHFERTTPTPIVDMGAILRLLGLGVLGLLGYILICIYFIVLGGL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.