NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209691_1007040

Scaffold Ga0209691_1007040


Overview

Basic Information
Taxon OID3300027279 Open in IMG/M
Scaffold IDGa0209691_1007040 Open in IMG/M
Source Dataset NameAnoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4154
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (57.14%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location NameUSA: Wyoming: Yellowstone National Park
CoordinatesLat. (o)44.963Long. (o)-110.715Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016816Metagenome / Metatranscriptome244Y
F066537Metagenome / Metatranscriptome126N

Sequences

Protein IDFamilyRBSSequence
Ga0209691_10070401F066537N/AIAGIPYAVDRPTTSANSFGGISRSNTTNPWWRAVVVDAGNQPLTLQRLAAAYNLATENGGISPDIIVMPTAHFSAFEALLLATQQYRQDDEIARAGFVGYLFKGATVLFDPRVPTNTIFILNSRDIMLVSQTERPSAEPVEFPDRLVRGYKHGWAVALVAKRLNSNARINNITT
Ga0209691_10070404F016816GGAGGMNTIYNPITGQWERLDDVLRPFPVIARDTRLIATNNTAPFVPAQGALNIPNHTDIFGNTDSSRANIGITVENTSADVVVPDVWRIRRFIILCNRSGSGTTSVNIHCVLWGRLLAPDGTPTIWRQVAVSTDAGSNSTPIRFLVPSSLAGALGYDQYRITFRREQNSDPAPELSLVRVYAEF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.