Scaffold Ga0209691_1014894

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209691_1014894

Scaffold Ga0209691_1014894

Overview

Basic Information
Taxon OID	3300027279 Open in IMG/M
Scaffold ID	Ga0209691_1014894 Open in IMG/M
Source Dataset Name	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2158
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location Name	USA: Wyoming: Yellowstone National Park
Coordinates	Lat. (^o)	44.963	Long. (^o)	-110.715	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026891	Metagenome / Metatranscriptome	196	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209691_10148942	F026891	GGAGG	MTIIAGAPIKTETNCGNIFGNCRLWFAQNGRTRTRLALYAAQGLHIECVDTKVYLARDAVPVWVGDERSREASVYLHADPDEKDGLYAVWLNTHCGFSVFPKDAVLWQASSVGGRKNSASQIAVVNPGCYIERYSYKFAMPSYWHAITLDGAVRSLGEQSYIIALASRGDKDAARLAELKGWRLITGRLEVQDEL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.