NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208525_1006838

Scaffold Ga0208525_1006838


Overview

Basic Information
Taxon OID3300027288 Open in IMG/M
Scaffold IDGa0208525_1006838 Open in IMG/M
Source Dataset NameSoil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1213
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Rhizosphere Microbial Communities From Centre Inrs-Institut Armand-Frappier, Laval, Canada

Source Dataset Sampling Location
Location NameLaval, Canada
CoordinatesLat. (o)45.54Long. (o)-73.72Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059194Metagenome / Metatranscriptome134N
F065761Metagenome / Metatranscriptome127N

Sequences

Protein IDFamilyRBSSequence
Ga0208525_10068382F065761GAGGMKPSAFRIERLLAKVEAEVARRGLRARRYAFHPDEVAEAEAQGLPYALVPRVLSKQEWLERYGRPGAEAEFYARLRGGPVAFTRPGQRVAPAAPKPSEAIEPPENLQ
Ga0208525_10068383F059194GAGGMRKDFEQNFAGADESDVGPPPRGRSPTARERPFKLGPLGTLNQIIVALGKSIRAMADGTLDSQVGARICNGLGIMRACLETRKLEQLESRMDEIADRVAHERTGAARERTSTHEAQRLSY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.