NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208970_1007152

Scaffold Ga0208970_1007152


Overview

Basic Information
Taxon OID3300027298 Open in IMG/M
Scaffold IDGa0208970_1007152 Open in IMG/M
Source Dataset NameAmmonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C49A8_35 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2391
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location NameMonterey Bay, California, USA
CoordinatesLat. (o)36.25Long. (o)-122.2099Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000681Metagenome / Metatranscriptome939Y
F003326Metagenome / Metatranscriptome494Y

Sequences

Protein IDFamilyRBSSequence
Ga0208970_10071522F003326GGAGMATLKEKKKLIRTIKNPVRYFRLNFSRYGGEVAMGTITKDQYEYWSDNDGFEEYMSAVDFDADDANKEIPKRAQFDAPFYEYSNICHFSGPEWADSQTMYIEEVDKDGNAMENGEGGYVQDIQHDFGDLESLGALIKCTEEHNTGSKSCENEYYVFGQYFNKGGWHTPDIIKTGPDGIEIDKLTIEMVNADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVAKGDNL
Ga0208970_10071523F000681AGGAGMYKRDQHYNKKISKENLYKELDTHYNAETDLVRNLMSYAITDDLIETRHELSCANEELWCLNDWPEGEGFGSSDRSEYLRRIKETVAFERKFLQAENELVQINKLEESPKNDTVRAYMKMNDKLKEGMVA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.