NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207983_1002217

Scaffold Ga0207983_1002217


Overview

Basic Information
Taxon OID3300027310 Open in IMG/M
Scaffold IDGa0207983_1002217 Open in IMG/M
Source Dataset NameSoil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2066
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Rhizosphere Microbial Communities From Centre Inrs-Institut Armand-Frappier, Laval, Canada

Source Dataset Sampling Location
Location NameLaval, Canada
CoordinatesLat. (o)45.54Long. (o)-73.72Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000037Metagenome / Metatranscriptome4230Y
F004562Metagenome / Metatranscriptome433Y
F017394Metagenome / Metatranscriptome241Y

Sequences

Protein IDFamilyRBSSequence
Ga0207983_10022172F017394GGGGGMTEVLNEVACDEADQLAPSSDIVLGGSVSQRDTPTSLAALEDRDRRYELQAQQSLTAAFFGDPLPGRSALDRRRAEQARIARQSEA
Ga0207983_10022173F000037GAGGLDKDYLTLKRASASRPSGDCNDDDFDVLADGVVVGRIMKAAAAPEGMSWMWTLAFGHHEDRIPTRGYAATREAAIAAFAKSWRRE
Ga0207983_10022174F004562AGGAGMSTTVLAYLILFMGFITFLAGAFGALMLLFEEVAKTERVPFRYYAMMVALISGGLGLIGIGQGLRLLLLILGKE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.