NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208923_1007743

Scaffold Ga0208923_1007743


Overview

Basic Information
Taxon OID3300027320 Open in IMG/M
Scaffold IDGa0208923_1007743 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1878
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameColumbia River Estuary, USA
CoordinatesLat. (o)46.2Long. (o)-123.94Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008129Metagenome / Metatranscriptome338N
F009603Metagenome / Metatranscriptome315N

Sequences

Protein IDFamilyRBSSequence
Ga0208923_10077432F009603AGGAGLRTTYASKAALTLLEALTAKLTVSANSMESGNVVRSTSSSDVSVEFAEPGKGTAAPIEMLEMWESLLTDYDYAVTLLAGDAIPSPTDLQIYNKMLTAVLVSTTRYYGDFTQFRREATTRM
Ga0208923_10077433F008129N/AVGAGHADDFAALRRIQLQYNVHDMDVGVDSGYNTQAVYDACAEFSQSSASPINYPCGLRYPPEGGLRKPMLIGWLPMKGRETGARFTSKTGSIHPFGITTSTSMRTDAVQPLLVFDTEHMREVLQRLRKGTETHQWSVCSLPALLDAEGAFASDSDTYWKHLDSHLLKPTANRSGRIKHLWFKRNTRWPDHLHDCEIMQLAMVMLWGDLTSSTSENSSG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.