 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300027325 Open in IMG/M |
| Scaffold ID | Ga0209186_1008167 Open in IMG/M |
| Source Dataset Name | Marine algal microbial communities from Sidmouth, United Kingdom - Sidmouth_Male2 metaG (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 6295 |
| Total Scaffold Genes | 12 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (66.67%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Heteroconchia → Euheterodonta → Imparidentia → Neoheterodontei → Venerida → Veneroidea → Veneridae → Mercenaria → Mercenaria mercenaria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Marine → Genome And Metagenome Analysis Of Marine Red Algae Porphyra |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sidmouth, United Kingdom | |||||||
| Coordinates | Lat. (o) | 50.677 | Long. (o) | -3.24 | Alt. (m) | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F022581 | Metagenome | 213 | Y |
| F027093 | Metagenome | 195 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209186_10081676 | F022581 | N/A | MLHERRFFFLASKAMVFTLSCVYGRSLFTGYLASVINPTFGGAAGDTLACRVHLHVVPESCLLLPSGTVTGIAPIGLTRGARLPLVCATTLGVVGGDLQLERGALLLALCRLSKEPCWCRRATWQ |
| Ga0209186_10081678 | F027093 | GAG | MPVRIQSRPKGIRPRDAPLSKGRDGRNVAAILTGSNYQVASRIRLDAGRELVHRVIVDTGSGVSLVREALPPPEMEVAPLDAATAQLFDVNGGLVPITGTVTLTVRIGTYFTTVTCGVVRGMSVPLLLGTDCTGVHLLNICGPKGYIQVLDGCKVSILRRGKTVSYATADQHGKVGAAGEADAKVRLAREVVLPPLSRR |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |