Scaffold Ga0209589_1072794

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209589_1072794

Scaffold Ga0209589_1072794

Overview

Basic Information
Taxon OID	3300027357 Open in IMG/M
Scaffold ID	Ga0209589_1072794 Open in IMG/M
Source Dataset Name	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	518
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana

Source Dataset Sampling Location
Location Name	California, USA
Coordinates	Lat. (^o)	34.0722	Long. (^o)	-118.4441	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076938	Metagenome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209589_10727941	F076938	N/A	NSTXYLLLSNGCNPSITFLGNSTPPXYVTINNFIHCVXRIYFLLTDHMHNKALXTSFLFKHGSCCVSFICLSFCSCKMASQTVEEKTLTNKLSLVPFLFSLFSLPSTVYITSVSILSFFVFSFSLRXSLLTCLGVINFYFFXCPSCLK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.