Scaffold Ga0209969_1000424

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209969_1000424

Scaffold Ga0209969_1000424

Overview

Basic Information
Taxon OID	3300027360 Open in IMG/M
Scaffold ID	Ga0209969_1000424 Open in IMG/M
Source Dataset Name	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5646
Total Scaffold Genes	9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere → Arabidopsis Thaliana Rhizosphere Microbial Communities From The Joint Genome Institute, Usa, That Affect Carbon Cycling

Source Dataset Sampling Location
Location Name	Joint Genome Institute, California, USA
Coordinates	Lat. (^o)	37.931388	Long. (^o)	-122.021761	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012397	Metagenome	281	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209969_10004247	F012397	GGA	VSVRIKRNKNNKKGVRWNRILILIVLVTTLSLLSGPSLSFSEIKNEINVTPPLNWEPSPTNNSTTMIWFQNSTKSIFAIIKAPDDLVFPLFIAGPFMTGYLKYKGVLESADRLTFGHSNYGYRYFLNLSSPSKLLDSSSGLIPKNEFLSKIPEGYDVPFKGMLILTQKHNELYAIIFLNPKEKFDSMLNQIQPTLDSIQLSG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.