NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209010_1000056

Scaffold Ga0209010_1000056


Overview

Basic Information
Taxon OID3300027370 Open in IMG/M
Scaffold IDGa0209010_1000056 Open in IMG/M
Source Dataset NameForest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)45359
Total Scaffold Genes43 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)30 (69.77%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameThunder Bay, Ontario, Canada
CoordinatesLat. (o)49.08Long. (o)-89.38Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006188Metagenome / Metatranscriptome379Y
F010577Metagenome / Metatranscriptome302Y
F052075Metagenome / Metatranscriptome143Y

Sequences

Protein IDFamilyRBSSequence
Ga0209010_100005610F052075GAGGMDADLVYSYLIDSTWFFLGSWVVLLLTAGIVAFAERLGPRILLLMGLMRRN
Ga0209010_100005624F010577GAGGMVSPVTTAFARVTSHSRLAPSLVGVQSSLLFALQFSNEFSSKKSNVYNILWVLVFGFATLNILGLVARRFEPRRSSLNFGEILAITVTVVSVVLLGLEMLSLFHIFPIKIQPH
Ga0209010_10000569F006188AGGCGGVAATAVPTDVVDVIAAEMAIGVERAVECWMSEIEQALTDIHLTSLGRLNAVSEILNEYKRLTGKAQLKDRTIC
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.