NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209332_1000544

Scaffold Ga0209332_1000544


Overview

Basic Information
Taxon OID3300027439 Open in IMG/M
Scaffold IDGa0209332_1000544 Open in IMG/M
Source Dataset NameForest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8485
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (90.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameThunder Bay, Ontario, Canada
CoordinatesLat. (o)49.08Long. (o)-89.38Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000850Metagenome / Metatranscriptome861Y
F014775Metagenome / Metatranscriptome260Y
F017683Metagenome / Metatranscriptome239Y

Sequences

Protein IDFamilyRBSSequence
Ga0209332_10005445F017683GGAGMKFLKQLFGRGCFHRFSWPRVDAVGHHYRICSHCGTAYEYDWTLMKRTERLLVTDLRT
Ga0209332_10005448F000850GGAMKKPELIDTGWLGPRSEMDRASHRFGKCSECHKIICVEKAVAEGPSSQRETSRMLDKAFRAHVELEHSNQD
Ga0209332_10005449F014775AGGAGMLSVHVDNVGEMAVIECEGRIVRSEDAFKLRNAVNLQSDSRIIVLDLSEVSAIAGGGLGMLVFLQRWTYDHDIKLKLFNPRLSVWNGLKHTNSMRAFDIATLDEMMALLASATLDETMALLPGPDGQYEQAA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.